CXorf66 Antikörper (Middle Region)

Produktnummer ABIN635057

Der Kaninchen Polyklonal Anti-CXorf66-Antikörper wurde für WB validiert. Er ist geeignet, CXorf66 in Proben von Human zu detektieren.

Kurzübersicht für CXorf66 Antikörper (Middle Region) (ABIN635057)

Target: CXorf66 (Chromosome X Open Reading Frame 66 (CXorf66))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CXorf66 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CXorf66 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CXorf66 antibody was raised against the middle region of CXorf66

Aufreinigung: Affinity purified

Immunogen: CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CXorf66 Blocking Peptide, (ABIN5613055), is also available for use as a blocking control in assays to test for specificity of this CXorf66 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXorf66 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CXorf66

Target: CXorf66 (Chromosome X Open Reading Frame 66 (CXorf66))

Andere Bezeichnung: CXorf66

Hintergrund: The protein encoded by this gene is predicted to be a type I membrane protein, however, its exact function is not known.

Molekulargewicht: 40 kDa (MW of target protein)