Cell Cycle Exit and Neuronal Differentiation 1 (CEND1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635055
Antigen
Epitop
N-Term
5
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
29
22
15
2
1
1
1
Wirt
Kaninchen
28
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
2
Applikation
Western Blotting (WB)
14
13
5
3
2
1
1
Optionen
Immunogen CEND1 antibody was raised using the N terminal of CEND1 corresponding to a region with amino acids MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ
Spezifität CEND1 antibody was raised against the N terminal of CEND1
Reinigung Affinity purified
Antigen
Andere Bezeichnung CEND1 (CEND1 Antibody Abstract)
Hintergrund CEND1 is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.
Molekulargewicht 15 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

CEND1 Blocking Peptide, catalog no. 33R-5964, is also available for use as a blocking control in assays to test for specificity of this CEND1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEND1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Cell Cycle Exit and Neuronal Differentiation 1 (CEND1) (N-Term) antibody (ABIN635055) CEND1 antibody used at 1 ug/ml to detect target protein.