AFG3L2 Antikörper

Produktnummer ABIN635053

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch AFG3L2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für AFG3L2 Antikörper (ABIN635053)

Target: AFG3L2 (AFG3-Like Protein 2 (AFG3L2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AFG3L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AFG3L2 Antikörper

Aufreinigung: Affinity purified

Immunogen: AFG3 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AFG3L2 Blocking Peptide, (ABIN5611968), is also available for use as a blocking control in assays to test for specificity of this AFG3L2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFG0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AFG3L2

Target: AFG3L2 (AFG3-Like Protein 2 (AFG3L2))

Andere Bezeichnung: AFG3L2

Hintergrund: AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.

Molekulargewicht: 88 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development