Monoamine Oxidase B Antikörper (C-Term)

Produktnummer ABIN635051

Produktdetails anti-Monoamine Oxidase B Antikörper

Target: Monoamine Oxidase B (MAOB)

Bindungsspezifität: C-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Monoamine Oxidase B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAOB antibody was raised against the C terminal of MAOB

Aufreinigung: Affinity purified

Immunogen: MAOB antibody was raised using the C terminal of MAOB corresponding to a region with amino acids GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAOB Blocking Peptide, catalog no. 33R-3365, is also available for use as a blocking control in assays to test for specificity of this MAOB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Monoamine Oxidase B

Target: Monoamine Oxidase B (MAOB)

Andere Bezeichnung: MAOB (MAOB Produkte)

Hintergrund: MAOB belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.

Molekulargewicht: 59 kDa (MW of target protein)