Monoamine Oxidase B Antikörper (N-Term)
-
- Target Alle Monoamine Oxidase B (MAOB) Antikörper anzeigen
- Monoamine Oxidase B (MAOB)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Monoamine Oxidase B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAOB antibody was raised against the N terminal of MAOB
- Aufreinigung
- Affinity purified
- Immunogen
- MAOB antibody was raised using the N terminal of MAOB corresponding to a region with amino acids RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV
- Top Product
- Discover our top product MAOB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAOB Blocking Peptide, catalog no. 33R-7858, is also available for use as a blocking control in assays to test for specificity of this MAOB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Monoamine Oxidase B (MAOB)
- Andere Bezeichnung
- MAOB (MAOB Produkte)
- Synonyme
- MAOB antikoerper, Z-MAO antikoerper, maob antikoerper, moa antikoerper, wu:fb68b05 antikoerper, wu:fo76d11 antikoerper, wu:fq38g06 antikoerper, zgc:85761 antikoerper, MAOA antikoerper, 6330414K01Rik antikoerper, MAO-B antikoerper, monoamine oxidase B antikoerper, amine oxidase [flavin-containing] B antikoerper, monoamine oxidase antikoerper, monoamine oxidase B L homeolog antikoerper, MAOB antikoerper, Gbro_4276 antikoerper, LOC100223232 antikoerper, mao antikoerper, Maob antikoerper, maob.L antikoerper
- Hintergrund
- MAOB belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.
- Molekulargewicht
- 59 kDa (MW of target protein)
-