SLC25A28 Antikörper (Middle Region)

Produktnummer ABIN635048

Produktdetails anti-SLC25A28 Antikörper

Target: SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC25 A28 antibody was raised against the middle region of SLC25 28

Aufreinigung: Affinity purified

Immunogen: SLC25 A28 antibody was raised using the middle region of SLC25 28 corresponding to a region with amino acids VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A28 Blocking Peptide, catalog no. 33R-9911, is also available for use as a blocking control in assays to test for specificity of this SLC25A28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A28

Target: SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))

Andere Bezeichnung: SLC25A28 (SLC25A28 Produkte)

Synonyme: MFRN2 antikoerper, MRS3/4 antikoerper, MRS4L antikoerper, 2210403D18Rik antikoerper, Mfrn2 antikoerper, Mrs3/4 antikoerper, mfrn2 antikoerper, wu:fc48b02 antikoerper, wu:fc66h02 antikoerper, zgc:64212 antikoerper, mrs3/4 antikoerper, mrs4l antikoerper, npd016 antikoerper, slc25a28-a antikoerper, slc25a28-b antikoerper, slc25a28 antikoerper, solute carrier family 25 member 28 antikoerper, mitoferrin-2-like antikoerper, solute carrier family 25, member 28 antikoerper, solute carrier family 25 (mitochondrial iron transporter), member 28 antikoerper, solute carrier family 25 member 28 L homeolog antikoerper, solute carrier family 25 member 28 S homeolog antikoerper, SLC25A28 antikoerper, LOC100226611 antikoerper, Slc25a28 antikoerper, slc25a28 antikoerper, slc25a28.L antikoerper, slc25a28.S antikoerper

Hintergrund: SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis