SLC25A28 Antikörper (Solute Carrier Family 25, Member 28) (Middle Region)

Details for Product anti-SLC25A28 Antibody No. ABIN635048
Antigen
Epitop
Middle Region
10
9
7
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
39
19
18
4
3
3
3
3
2
1
1
1
Wirt
Kaninchen
39
Klonalität
Polyklonal
Konjugat
Dieser SLC25A28 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
27
19
17
15
13
6
Optionen
Immunogen SLC25 A28 antibody was raised using the middle region of SLC25 28 corresponding to a region with amino acids VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH
Spezifität SLC25 A28 antibody was raised against the middle region of SLC25 28
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC25A28 (SLC25A28 Antibody Abstract)
Hintergrund SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.
Molekulargewicht 39 kDa (MW of target protein)
Pathways Transition Metal Ion Homeostasis
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC25A28 Blocking Peptide, catalog no. 33R-9911, is also available for use as a blocking control in assays to test for specificity of this SLC25A28 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 28 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 25, Member 28 (SLC25A28) (Middle Region) antibody (ABIN635048) SLC25A28 antibody used at 1 ug/ml to detect target protein.