SLC25A38 Antikörper (Solute Carrier Family 25, Member 38) (Middle Region)

Details for Product anti-SLC25A38 Antibody No. ABIN635042
Antigen
Epitop
Middle Region
4
3
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus), Hund
33
9
6
4
3
2
2
2
1
1
1
1
Wirt
Kaninchen
26
7
Klonalität
Polyklonal
Konjugat
Dieser SLC25A38 Antikörper ist unkonjugiert
4
3
2
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
18
17
9
2
1
1
Optionen
Immunogen SLC25 A38 antibody was raised using the middle region of SLC25 38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR
Spezifität SLC25 A38 antibody was raised against the middle region of SLC25 38
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC25A38 (SLC25A38 Antibody Abstract)
Hintergrund SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
Molekulargewicht 33 kDa (MW of target protein)
Applikations-hinweise WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC25A38 Blocking Peptide, catalog no. 33R-9563, is also available for use as a blocking control in assays to test for specificity of this SLC25A38 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 38 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 25, Member 38 (SLC25A38) (Middle Region) antibody (ABIN635042) SLC25A38 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml t...
Image no. 2 for anti-Solute Carrier Family 25, Member 38 (SLC25A38) (Middle Region) antibody (ABIN635042) SLC25A38 antibody used at 0.25 ug/ml to detect target protein.