SLC25A38 Antikörper (Middle Region)

Produktnummer ABIN635042

Der Kaninchen Polyklonal Anti-SLC25A38-Antikörper wurde für WB und IHC validiert. Er ist geeignet, SLC25A38 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für SLC25A38 Antikörper (Middle Region) (ABIN635042)

Target: SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A38 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SLC25A38 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC25 A38 antibody was raised against the middle region of SLC25 38

Aufreinigung: Affinity purified

Immunogen: SLC25 A38 antibody was raised using the middle region of SLC25 38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A38 Blocking Peptide, catalog no. 33R-9563, is also available for use as a blocking control in assays to test for specificity of this SLC25A38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A38

Target: SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))

Andere Bezeichnung: SLC25A38

Hintergrund: SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.

Molekulargewicht: 33 kDa (MW of target protein)