MFN2 Antikörper (C-Term)

Produktnummer ABIN635034

Produktdetails anti-MFN2 Antikörper

Target: MFN2 (Mitofusin 2 (MFN2))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Mitofusin 2 antibody was raised against the C terminal of MFN2

Aufreinigung: Affinity purified

Immunogen: Mitofusin 2 antibody was raised using the C terminal of MFN2 corresponding to a region with amino acids LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Mitofusin 2 Blocking Peptide, catalog no. 33R-4923, is also available for use as a blocking control in assays to test for specificity of this Mitofusin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFN2

Target: MFN2 (Mitofusin 2 (MFN2))

Andere Bezeichnung: Mitofusin 2 (MFN2 Produkte)

Synonyme: CG3869 antikoerper, Dmel\\CG3869 antikoerper, MARF antikoerper, Marf-1 antikoerper, Mfn antikoerper, anon-WO0125274.3 antikoerper, dMFN antikoerper, dMfn antikoerper, dmfn antikoerper, marf antikoerper, mfn antikoerper, mfn2 antikoerper, MFN2 antikoerper, hsg antikoerper, cmt2a antikoerper, cprp1 antikoerper, cmt2a2 antikoerper, CMT2A antikoerper, CMT2A2 antikoerper, CPRP1 antikoerper, HSG antikoerper, D630023P19Rik antikoerper, Fzo antikoerper, mg:cb01g09 antikoerper, si:dkeyp-104h9.2 antikoerper, wu:fb79a11 antikoerper, mitofusin 2 antikoerper, Mitochondrial assembly regulatory factor antikoerper, mitofusin-2 antikoerper, mitofusin 2 L homeolog antikoerper, MFN2 antikoerper, Marf antikoerper, mfn2 antikoerper, LOC100186475 antikoerper, Mfn2 antikoerper, mfn2.L antikoerper

Hintergrund: MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development