MFN2 Antikörper (C-Term)

Produktnummer ABIN635034

Dieses Anti-MFN2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MFN2 in WB. Geeignet für Human und Ratte.

Kurzübersicht für MFN2 Antikörper (C-Term) (ABIN635034)

Target: MFN2 (Mitofusin 2 (MFN2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MFN2 Antikörper

Bindungsspezifität: C-Term

Spezifität: Mitofusin 2 antibody was raised against the C terminal of MFN2

Aufreinigung: Affinity purified

Immunogen: Mitofusin 2 antibody was raised using the C terminal of MFN2 corresponding to a region with amino acids LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Mitofusin 2 Blocking Peptide, (ABIN940309), is also available for use as a blocking control in assays to test for specificity of this Mitofusin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFN2

Target: MFN2 (Mitofusin 2 (MFN2))

Andere Bezeichnung: Mitofusin 2

Hintergrund: MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development