ROBO2 Antikörper

Produktnummer ABIN635030

Produktdetails anti-ROBO2 Antikörper

Target: ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ROBO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ROBO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ROBO2 Blocking Peptide, catalog no. 33R-7307, is also available for use as a blocking control in assays to test for specificity of this ROBO2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROBO2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ROBO2

Target: ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))

Andere Bezeichnung: ROBO2 (ROBO2 Produkte)

Synonyme: SAX3 antikoerper, ROBO2 antikoerper, CG14347 antikoerper, CG14348 antikoerper, CG5481 antikoerper, CG5574 antikoerper, CT17326 antikoerper, D-Robo2 antikoerper, D-robo2 antikoerper, Dmel\\CG5481 antikoerper, Robo 2 antikoerper, Robo-2 antikoerper, Robo2 antikoerper, anon-EST:Liang-1.75 antikoerper, clone 1.75 antikoerper, dRobo-2 antikoerper, fus4 antikoerper, robo-2 antikoerper, robo2 antikoerper, unp1881 antikoerper, 2600013A04Rik antikoerper, 9430089E08Rik antikoerper, BB097918 antikoerper, D230004I22Rik antikoerper, mKIAA1568 antikoerper, sax3 antikoerper, roundabout guidance receptor 2 antikoerper, roundabout 2 antikoerper, roundabout, axon guidance receptor, homolog 2 (Drosophila) antikoerper, roundabout guidance receptor 2 S homeolog antikoerper, ROBO2 antikoerper, Robo2 antikoerper, robo2 antikoerper, robo2.S antikoerper

Hintergrund: ROBO2 belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. ROBO2 is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for ROBO2.

Molekulargewicht: 151 kDa (MW of target protein)

Pathways: Regulation of Cell Size