ACSL1 Antikörper (N-Term)

Produktnummer ABIN635029

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ACSL1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ACSL1 Antikörper (N-Term) (ABIN635029)

Target: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACSL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACSL1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACSL1 antibody was raised against the N terminal of ACSL1

Aufreinigung: Affinity purified

Immunogen: ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACSL1 Blocking Peptide, catalog no. 33R-1349, is also available for use as a blocking control in assays to test for specificity of this ACSL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACSL1

Target: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Andere Bezeichnung: ACSL1

Hintergrund: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.

Molekulargewicht: 78 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha