ELOVL5 Antikörper

Produktnummer ABIN635023

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ELOVL5 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für ELOVL5 Antikörper (ABIN635023)

Target: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ELOVL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ELOVL5 Antikörper

Aufreinigung: Affinity purified

Immunogen: ELOVL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ELOVL5 Blocking Peptide, (ABIN937837), is also available for use as a blocking control in assays to test for specificity of this ELOVL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ELOVL5

Target: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Andere Bezeichnung: ELOVL5

Hintergrund: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.

Molekulargewicht: 35 kDa (MW of target protein)