ERGIC3 Antikörper (C-Term)

Produktnummer ABIN635020

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ERGIC3 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ERGIC3 Antikörper (C-Term) (ABIN635020)

Target: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERGIC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ERGIC3 Antikörper

Bindungsspezifität: C-Term

Spezifität: ERGIC3 antibody was raised against the C terminal of ERGIC3

Aufreinigung: Affinity purified

Immunogen: ERGIC3 antibody was raised using the C terminal of ERGIC3 corresponding to a region with amino acids LTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERGIC3 Blocking Peptide, (ABIN5613395), is also available for use as a blocking control in assays to test for specificity of this ERGIC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERGIC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERGIC3

Target: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Andere Bezeichnung: ERGIC3

Hintergrund: ERGIC3 plays a possible role in transport between endoplasmic reticulum and Golgi.

Molekulargewicht: 43 kDa (MW of target protein)