NCAM2 Antikörper (Neural Cell Adhesion Molecule 2) (Middle Region)

Details for Product anti-NCAM2 Antibody No. ABIN635019
Antigen
Epitop
Middle Region
16
11
9
7
4
2
2
2
2
1
1
1
1
1
1
1
1
Reaktivität
Human
71
46
31
2
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
65
7
2
1
Klonalität
Polyklonal
Konjugat
Dieser NCAM2 Antikörper ist unkonjugiert
5
5
5
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
50
40
13
10
5
3
2
2
1
Optionen
Immunogen NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL
Spezifität NCAM2 antibody was raised against the middle region of NCAM2
Reinigung Affinity purified
Antigen
Andere Bezeichnung NCAM2 (NCAM2 Antibody Abstract)
Hintergrund The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
Molekulargewicht 91 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

NCAM2 Blocking Peptide, catalog no. 33R-4400, is also available for use as a blocking control in assays to test for specificity of this NCAM2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAM2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Neural Cell Adhesion Molecule 2 (NCAM2) (Middle Region) antibody (ABIN635019) NCAM2 antibody used at 1 ug/ml to detect target protein.