NCAM2 Antikörper (Middle Region)
-
- Target Alle NCAM2 Antikörper anzeigen
- NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NCAM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NCAM2 antibody was raised against the middle region of NCAM2
- Aufreinigung
- Affinity purified
- Immunogen
- NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL
- Top Product
- Discover our top product NCAM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NCAM2 Blocking Peptide, catalog no. 33R-4400, is also available for use as a blocking control in assays to test for specificity of this NCAM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))
- Andere Bezeichnung
- NCAM2 (NCAM2 Produkte)
- Synonyme
- NCAM21 antikoerper, Ncam-2 antikoerper, Ocam antikoerper, RNCAM antikoerper, zOCAM antikoerper, OCAM-GPI antikoerper, NCAM2 antikoerper, ncam21 antikoerper, neural cell adhesion molecule 2 antikoerper, zgc:152904 antikoerper, NCAM2 antikoerper, Ncam2 antikoerper, ncam2 antikoerper, LOC100471034 antikoerper, zgc:152904 antikoerper
- Hintergrund
- The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
- Molekulargewicht
- 91 kDa (MW of target protein)
-