TMEM30B Antikörper (Transmembrane Protein 30B) (Middle Region)

Details for Product anti-TMEM30B Antibody No. ABIN635017
Antigen
Epitop
Middle Region
8
4
3
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
32
14
3
2
2
1
1
Wirt
Kaninchen
32
Klonalität
Polyklonal
Konjugat
Dieser TMEM30B Antikörper ist unkonjugiert
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
26
22
10
9
4
1
1
Optionen
Immunogen TMEM30 B antibody was raised using the middle region of TMEM30 corresponding to a region with amino acids VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL
Spezifität TMEM30 B antibody was raised against the middle region of TMEM30
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM30B
Hintergrund TMEM30B belongs to the CDC50/LEM3 family. It is a multi-pass membrane protein. The function of the TMEM30B protein remains unknown.
Molekulargewicht 39 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM30B Blocking Peptide, catalog no. 33R-9922, is also available for use as a blocking control in assays to test for specificity of this TMEM30B antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Transmembrane Protein 30B (TMEM30B) (Middle Region) antibody (ABIN635017) TMEM30B antibody used at 1 ug/ml to detect target protein.