NBC4 Antikörper (Middle Region)

Produktnummer ABIN635011

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch NBC4 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für NBC4 Antikörper (Middle Region) (ABIN635011)

Target: NBC4 (Electrogenic Sodium Bicarbonate Cotransporter 4 (NBC4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NBC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NBC4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC4 A5 antibody was raised against the middle region of SLC4 5

Aufreinigung: Affinity purified

Immunogen: SLC4 A5 antibody was raised using the middle region of SLC4 5 corresponding to a region with amino acids SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC4A5 Blocking Peptide, (ABIN5616264), is also available for use as a blocking control in assays to test for specificity of this SLC4A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NBC4

Target: NBC4 (Electrogenic Sodium Bicarbonate Cotransporter 4 (NBC4))

Andere Bezeichnung: SLC4A5

Hintergrund: This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation.

Molekulargewicht: 126 kDa (MW of target protein)