TMEM195 Antikörper (Middle Region)

Produktnummer ABIN635006

Produktdetails anti-TMEM195 Antikörper

Target: TMEM195 (Transmembrane Protein 195 (TMEM195))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM195 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM195 antibody was raised against the middle region of TMEM195

Aufreinigung: Affinity purified

Immunogen: TMEM195 antibody was raised using the middle region of TMEM195 corresponding to a region with amino acids AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM195 Blocking Peptide, catalog no. 33R-1200, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM195

Target: TMEM195 (Transmembrane Protein 195 (TMEM195))

Andere Bezeichnung: TMEM195 (TMEM195 Produkte)

Hintergrund: TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.

Molekulargewicht: 51 kDa (MW of target protein)