TMEM138 Antikörper (Transmembrane Protein 138) (N-Term)

Details for Product anti-TMEM138 Antibody No. ABIN635004
Antigen
Epitop
N-Term
2
Reaktivität
Human
4
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
4
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
4
1
1
Optionen
Immunogen TMEM138 antibody was raised using the N terminal of TMEM138 corresponding to a region with amino acids MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVL
Spezifität TMEM138 antibody was raised against the N terminal of TMEM138
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM138 (TMEM138 Antibody Abstract)
Hintergrund TMEM138 is a multi-pass membrane protein.It belongs to the TMEM138 family. The function of the TMEM138 protein remains unknown.
Molekulargewicht 19 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM138 Blocking Peptide, catalog no. 33R-6207, is also available for use as a blocking control in assays to test for specificity of this TMEM138 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM138 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Transmembrane Protein 138 (TMEM138) (N-Term) antibody (ABIN635004) TMEM138 antibody used at 1 ug/ml to detect target protein.