CEACAM16 Antikörper (Middle Region)

Produktnummer ABIN635003

Produktdetails anti-CEACAM16 Antikörper

Target: CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CEACAM16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CEACAM16 antibody was raised against the middle region of CEACAM16

Aufreinigung: Affinity purified

Immunogen: CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CEACAM16 Blocking Peptide, catalog no. 33R-9368, is also available for use as a blocking control in assays to test for specificity of this CEACAM16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CEACAM16

Target: CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))

Andere Bezeichnung: CEACAM16 (CEACAM16 Produkte)

Synonyme: CEAL2 antikoerper, DFNA4B antikoerper, Gm769 antikoerper, Bcl3 antikoerper, carcinoembryonic antigen related cell adhesion molecule 16 antikoerper, carcinoembryonic antigen-related cell adhesion molecule 16 antikoerper, CEACAM16 antikoerper, Ceacam16 antikoerper

Hintergrund: CEACAM16 is a single-pass type I membrane protein.It belongs to the immunoglobulin superfamily, CEA family.It contains 2 Ig-like C2-type (immunoglobulin-like) domains. The exact function of CEACAM16 remains unknown.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Sensory Perception of Sound