ALG11 Antikörper
-
- Target Alle ALG11 Antikörper anzeigen
- ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALG11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALG11 antibody was yeast alpha-12-mannosyltransferase
- Aufreinigung
- Affinity purified
- Immunogen
- ALG11 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA
- Top Product
- Discover our top product ALG11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALG11 Blocking Peptide, catalog no. 33R-5418, is also available for use as a blocking control in assays to test for specificity of this ALG11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))
- Andere Bezeichnung
- ALG11 (ALG11 Produkte)
- Synonyme
- UTP14C antikoerper, CDG1P antikoerper, GT8 antikoerper, RGD1564725 antikoerper, AI849156 antikoerper, AW492253 antikoerper, B230397C21 antikoerper, si:dkey-1h24.5 antikoerper, wu:fj04e04 antikoerper, asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase antikoerper, ALG11, alpha-1,2-mannosyltransferase antikoerper, ALG11, alpha-1,2-mannosyltransferase L homeolog antikoerper, asparagine-linked glycosylation 11 (alpha-1,2-mannosyltransferase) antikoerper, alg11 antikoerper, ALG11 antikoerper, alg11.L antikoerper, Alg11 antikoerper
- Hintergrund
- ALG11 is a GDP-Man:Man3GlcNAc2-PP-dolichol-alpha1,2-mannosyltransferase which is localized to the cytosolic side of the endoplasmic reticulum (ER) and catalyzes the transfer of the fourth and fifth mannose residue from GDP-mannose (GDP-Man) to Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol resulting in the production of Man5GlcNAc2-PP-dolichol. Mutations in this gene are associated with congenital disorder of glycosylation type Ip (CDGIP).
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-