Slc26a9 Antikörper (Middle Region)
-
- Target Alle Slc26a9 Antikörper anzeigen
- Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Slc26a9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC26 A9 antibody was raised against the middle region of SLC26 9
- Aufreinigung
- Affinity purified
- Immunogen
- SLC26 A9 antibody was raised using the middle region of SLC26 9 corresponding to a region with amino acids LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD
- Top Product
- Discover our top product Slc26a9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC26A9 Blocking Peptide, catalog no. 33R-4781, is also available for use as a blocking control in assays to test for specificity of this SLC26A9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))
- Andere Bezeichnung
- SLC26A9 (Slc26a9 Produkte)
- Hintergrund
- This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.
- Molekulargewicht
- 87 kDa (MW of target protein)
-