Slc26a9 Antikörper (Middle Region)

Produktnummer ABIN634992

Dieses Anti-Slc26a9-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Slc26a9 in WB. Geeignet für Human.

Kurzübersicht für Slc26a9 Antikörper (Middle Region) (ABIN634992)

Target: Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Slc26a9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Slc26a9 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC26 A9 antibody was raised against the middle region of SLC26 9

Aufreinigung: Affinity purified

Immunogen: SLC26 A9 antibody was raised using the middle region of SLC26 9 corresponding to a region with amino acids LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC26A9 Blocking Peptide, (ABIN940167), is also available for use as a blocking control in assays to test for specificity of this SLC26A9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Slc26a9

Target: Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))

Andere Bezeichnung: SLC26A9

Hintergrund: This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.

Molekulargewicht: 87 kDa (MW of target protein)