VSIG8 Antikörper (V-Set and Immunoglobulin Domain Containing 8) (N-Term)

Details for Product anti-VSIG8 Antibody No. ABIN634989
Antigen
Epitop
N-Term
11
11
8
1
Reaktivität
Human, Maus, Ratte (Rattus)
35
24
2
1
1
1
1
1
1
Wirt
Kaninchen
33
3
Klonalität
Polyklonal
Konjugat
Dieser VSIG8 Antikörper ist unkonjugiert
3
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
28
22
22
3
1
1
Optionen
Immunogen VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT
Spezifität VSIG8 antibody was raised against the N terminal of VSIG8
Reinigung Affinity purified
Antigen
Andere Bezeichnung VSIG8
Hintergrund VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.
Molekulargewicht 44 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

VSIG8 Blocking Peptide, catalog no. 33R-3838, is also available for use as a blocking control in assays to test for specificity of this VSIG8 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG8 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-V-Set and Immunoglobulin Domain Containing 8 (VSIG8) (N-Term) antibody (ABIN634989) VSIG8 antibody used at 1 ug/ml to detect target protein.