VSIG8 Antikörper (N-Term)

Produktnummer ABIN634989

Dieses Anti-VSIG8-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von VSIG8 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für VSIG8 Antikörper (N-Term) (ABIN634989)

Target: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VSIG8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VSIG8 Antikörper

Bindungsspezifität: N-Term

Spezifität: VSIG8 antibody was raised against the N terminal of VSIG8

Aufreinigung: Affinity purified

Immunogen: VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VSIG8 Blocking Peptide, (ABIN939224), is also available for use as a blocking control in assays to test for specificity of this VSIG8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VSIG8

Target: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Andere Bezeichnung: VSIG8

Hintergrund: VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.

Molekulargewicht: 44 kDa (MW of target protein)