ATG9A Antikörper

Produktnummer ABIN634988

Der Kaninchen Polyklonal Anti-ATG9A-Antikörper wurde für WB validiert. Er ist geeignet, ATG9A in Proben von Human zu detektieren.

Kurzübersicht für ATG9A Antikörper (ABIN634988)

Target: ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATG9A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATG9A Antikörper

Aufreinigung: Affinity purified

Immunogen: ATG9 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATG9A Blocking Peptide, catalog no. 33R-9437, is also available for use as a blocking control in assays to test for specificity of this ATG9A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATG9A

Target: ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))

Andere Bezeichnung: ATG9A

Hintergrund: ATG9A belongs to the ATG9 family. It plays a role in autophagy.

Molekulargewicht: 94 kDa (MW of target protein)