GGT7 Antikörper (C-Term)

Produktnummer ABIN634986

Dieses Anti-GGT7-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GGT7 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für GGT7 Antikörper (C-Term) (ABIN634986)

Target: GGT7 (gamma-Glutamyltransferase 7 (GGT7))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GGT7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GGT7 Antikörper

Bindungsspezifität: C-Term

Spezifität: GGTL3 antibody was raised against the C terminal Of Ggtl3

Aufreinigung: Affinity purified

Immunogen: GGTL3 antibody was raised using the C terminal Of Ggtl3 corresponding to a region with amino acids ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GGTL3 Blocking Peptide, (ABIN939441), is also available for use as a blocking control in assays to test for specificity of this GGTL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GGT7

Target: GGT7 (gamma-Glutamyltransferase 7 (GGT7))

Andere Bezeichnung: GGTL3

Hintergrund: GGTL3 is an enzyme involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. GGTL3 consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis.

Molekulargewicht: 70 kDa (MW of target protein)