CKLF Antikörper (N-Term)

Produktnummer ABIN634980

Produktdetails anti-CKLF Antikörper

Target: CKLF (Chemokine-Like Factor (CKLF))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CKLF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CKLF antibody was raised against the N terminal of CKLF

Aufreinigung: Affinity purified

Immunogen: CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CKLF Blocking Peptide, catalog no. 33R-5854, is also available for use as a blocking control in assays to test for specificity of this CKLF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKLF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CKLF

Target: CKLF (Chemokine-Like Factor (CKLF))

Andere Bezeichnung: CKLF (CKLF Produkte)

Synonyme: C32 antikoerper, CKLF1 antikoerper, CKLF2 antikoerper, CKLF3 antikoerper, CKLF4 antikoerper, UCK-1 antikoerper, 1700001C14Rik antikoerper, 1810018M11Rik antikoerper, CKLF5 antikoerper, Cklf2 antikoerper, Cklf6 antikoerper, HSPC224 antikoerper, Cklf1 antikoerper, chemokine like factor antikoerper, chemokine-like factor antikoerper, CKLF antikoerper, Cklf antikoerper, LOC100727126 antikoerper, LOC101103916 antikoerper

Hintergrund: CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.

Molekulargewicht: 13 kDa (MW of target protein)