CKLF Antikörper (N-Term)

Produktnummer ABIN634980

Dieses Anti-CKLF-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CKLF in WB. Geeignet für Human.

Kurzübersicht für CKLF Antikörper (N-Term) (ABIN634980)

Target: CKLF (Chemokine-Like Factor (CKLF))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CKLF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CKLF Antikörper

Bindungsspezifität: N-Term

Spezifität: CKLF antibody was raised against the N terminal of CKLF

Aufreinigung: Affinity purified

Immunogen: CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CKLF Blocking Peptide, (ABIN5612902), is also available for use as a blocking control in assays to test for specificity of this CKLF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKLF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CKLF

Target: CKLF (Chemokine-Like Factor (CKLF))

Andere Bezeichnung: CKLF

Hintergrund: CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.

Molekulargewicht: 13 kDa (MW of target protein)