LRRN3 Antikörper (Leucine Rich Repeat Neuronal 3) (N-Term)

Details for Product anti-LRRN3 Antibody No. ABIN634977
Antigen
Epitop
N-Term
14
10
9
9
8
4
2
1
1
Reaktivität
Human
44
3
3
2
2
2
2
2
1
1
1
Wirt
Kaninchen
44
Klonalität
Polyklonal
Konjugat
Dieser LRRN3 Antikörper ist unkonjugiert
5
5
4
4
4
3
Applikation
Western Blotting (WB)
39
35
13
3
1
1
Optionen
Immunogen LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL
Spezifität LRRN3 antibody was raised against the N terminal of LRRN3
Reinigung Affinity purified
Antigen
Andere Bezeichnung LRRN3
Hintergrund LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.
Molekulargewicht 79 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

LRRN3 Blocking Peptide, catalog no. 33R-2582, is also available for use as a blocking control in assays to test for specificity of this LRRN3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Leucine Rich Repeat Neuronal 3 (LRRN3) (N-Term) antibody (ABIN634977) LRRN3 antibody used at 1 ug/ml to detect target protein.