LRRN3 Antikörper (N-Term)
-
- Target Alle LRRN3 Antikörper anzeigen
- LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRRN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRN3 antibody was raised against the N terminal of LRRN3
- Aufreinigung
- Affinity purified
- Immunogen
- LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL
- Top Product
- Discover our top product LRRN3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRN3 Blocking Peptide, catalog no. 33R-2582, is also available for use as a blocking control in assays to test for specificity of this LRRN3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))
- Andere Bezeichnung
- LRRN3 (LRRN3 Produkte)
- Synonyme
- nlrr3 antikoerper, nlrr-3 antikoerper, MGC146637 antikoerper, FIGLER5 antikoerper, NLRR-3 antikoerper, NLRR3 antikoerper, Nlrr3 antikoerper, leucine rich repeat neuronal 3 antikoerper, leucine rich repeat protein 3, neuronal antikoerper, LRRN3 antikoerper, lrrn3 antikoerper, Lrrn3 antikoerper
- Hintergrund
- LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.
- Molekulargewicht
- 79 kDa (MW of target protein)
-