LRRN3 Antikörper (N-Term)

Produktnummer ABIN634977

Dieses Anti-LRRN3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von LRRN3 in WB. Geeignet für Human.

Kurzübersicht für LRRN3 Antikörper (N-Term) (ABIN634977)

Target: LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRRN3 Antikörper

Bindungsspezifität: N-Term

Spezifität: LRRN3 antibody was raised against the N terminal of LRRN3

Aufreinigung: Affinity purified

Immunogen: LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRN3 Blocking Peptide, (ABIN937968), is also available for use as a blocking control in assays to test for specificity of this LRRN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRN3

Target: LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))

Andere Bezeichnung: LRRN3

Hintergrund: LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.

Molekulargewicht: 79 kDa (MW of target protein)