FAM19A3 Antikörper (Middle Region)

Produktnummer ABIN634975

Produktdetails anti-FAM19A3 Antikörper

Target: FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM19A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM19 A3 antibody was raised against the middle region of FAM19 3

Aufreinigung: Affinity purified

Immunogen: FAM19 A3 antibody was raised using the middle region of FAM19 3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM19A3 Blocking Peptide, catalog no. 33R-3058, is also available for use as a blocking control in assays to test for specificity of this FAM19A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM19A3

Target: FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))

Andere Bezeichnung: FAM19A3 (FAM19A3 Produkte)

Synonyme: TAFA-3 antikoerper, TAFA3 antikoerper, 7530404M11Rik antikoerper, Tafa-3 antikoerper, family with sequence similarity 19 member A3, C-C motif chemokine like antikoerper, family with sequence similarity 19, member A3 antikoerper, FAM19A3 antikoerper, Fam19a3 antikoerper

Hintergrund: FAM19A3 is a member of the TAFA family which is composed of five highly homologous small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.

Molekulargewicht: 18 kDa (MW of target protein)