FAM19A3 Antikörper (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3) (Middle Region)

Details for Product anti-FAM19A3 Antibody No. ABIN634975
Antigen
Epitop
Middle Region
4
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
9
4
3
2
2
2
1
1
1
1
1
1
Wirt
Kaninchen
10
Klonalität
Polyklonal
Konjugat
Dieser FAM19A3 Antikörper ist unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
6
5
2
2
Optionen
Immunogen FAM19 A3 antibody was raised using the middle region of FAM19 3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV
Spezifität FAM19 A3 antibody was raised against the middle region of FAM19 3
Reinigung Affinity purified
Antigen
Andere Bezeichnung FAM19A3 (FAM19A3 Antibody Abstract)
Hintergrund FAM19A3 is a member of the TAFA family which is composed of five highly homologous small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.
Molekulargewicht 18 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FAM19A3 Blocking Peptide, catalog no. 33R-3058, is also available for use as a blocking control in assays to test for specificity of this FAM19A3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3) (Middle Region) antibody (ABIN634975) FAM19A3 antibody used at 1 ug/ml to detect target protein.