FAM19A3 Antikörper (Middle Region)
-
- Target Alle FAM19A3 Antikörper anzeigen
- FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM19A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM19 A3 antibody was raised against the middle region of FAM19 3
- Aufreinigung
- Affinity purified
- Immunogen
- FAM19 A3 antibody was raised using the middle region of FAM19 3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV
- Top Product
- Discover our top product FAM19A3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM19A3 Blocking Peptide, catalog no. 33R-3058, is also available for use as a blocking control in assays to test for specificity of this FAM19A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))
- Andere Bezeichnung
- FAM19A3 (FAM19A3 Produkte)
- Hintergrund
- FAM19A3 is a member of the TAFA family which is composed of five highly homologous small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.
- Molekulargewicht
- 18 kDa (MW of target protein)
-