NDUFB5 Antikörper

Produktnummer ABIN634974

Produktdetails anti-NDUFB5 Antikörper

Target: NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDUFB5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NDUFB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDUFB5 Blocking Peptide, catalog no. 33R-4521, is also available for use as a blocking control in assays to test for specificity of this NDUFB5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFB5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDUFB5

Target: NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))

Andere Bezeichnung: NDUFB5 (NDUFB5 Produkte)

Synonyme: hm:zeh0024 antikoerper, zgc:123331 antikoerper, 0610007D05Rik antikoerper, AU015782 antikoerper, SGDH antikoerper, CISGDH antikoerper, NADH:ubiquinone oxidoreductase subunit B5 antikoerper, NADH:ubiquinone oxidoreductase subunit B5 L homeolog antikoerper, NADH dehydrogenase (ubiquinone) 1 beta subcomplex 5 antikoerper, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa antikoerper, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5 antikoerper, Ndufb5 antikoerper, ndufb5.L antikoerper, NDUFB5 antikoerper, ndufb5 antikoerper

Hintergrund: NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Molekulargewicht: 17 kDa (MW of target protein)