NDUFB5 Antikörper (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa)

Details for Product anti-NDUFB5 Antibody No. ABIN634974
Antigen
Reaktivität
Human
31
13
10
1
1
1
1
1
Wirt
Kaninchen
27
4
Klonalität
Polyklonal
Konjugat
Dieser NDUFB5 Antikörper ist unkonjugiert
2
2
2
Applikation
Western Blotting (WB)
24
16
7
4
4
3
2
1
Optionen
Immunogen NDUFB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS
Reinigung Affinity purified
Antigen
Andere Bezeichnung NDUFB5 (NDUFB5 Antibody Abstract)
Hintergrund NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Molekulargewicht 17 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

NDUFB5 Blocking Peptide, catalog no. 33R-4521, is also available for use as a blocking control in assays to test for specificity of this NDUFB5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFB5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5) antibody (ABIN634974) NDUFB5 antibody used at 1 ug/ml to detect target protein.