NDUFB5 Antikörper

Produktnummer ABIN634974

Dieser Anti-NDUFB5 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von NDUFB5 in WB. Geeignet für Human.

Kurzübersicht für NDUFB5 Antikörper (ABIN634974)

Target: NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDUFB5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NDUFB5 Antikörper

Aufreinigung: Affinity purified

Immunogen: NDUFB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDUFB5 Blocking Peptide, (ABIN939907), is also available for use as a blocking control in assays to test for specificity of this NDUFB5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFB5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDUFB5

Target: NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))

Andere Bezeichnung: NDUFB5

Hintergrund: NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Molekulargewicht: 17 kDa (MW of target protein)