CDS1 Antikörper

Produktnummer ABIN634970

Produktdetails anti-CDS1 Antikörper

Target: CDS1 (CDP-Diacylglycerol Synthase (Phosphatidate Cytidylyltransferase) 1 (CDS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CDS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDS1 Blocking Peptide, catalog no. 33R-9876, is also available for use as a blocking control in assays to test for specificity of this CDS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDS1

Target: CDS1 (CDP-Diacylglycerol Synthase (Phosphatidate Cytidylyltransferase) 1 (CDS1))

Andere Bezeichnung: CDS1 (CDS1 Produkte)

Synonyme: CDS antikoerper, 4833409J18Rik antikoerper, AI314024 antikoerper, AW125888 antikoerper, CDP-diacylglycerol synthase 1 antikoerper, CDS1 antikoerper, Cds1 antikoerper

Hintergrund: Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. CDS1 is an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Inositol Metabolic Process