MARVELD3 Antikörper (Middle Region)

Produktnummer ABIN634967

Der Kaninchen Polyklonal Anti-MARVELD3-Antikörper wurde für WB und IHC validiert. Er ist geeignet, MARVELD3 in Proben von Human, Maus und Hund zu detektieren.

Kurzübersicht für MARVELD3 Antikörper (Middle Region) (ABIN634967)

Target: MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MARVELD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MARVELD3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MARVELD3 antibody was raised against the middle region of MARVELD3

Aufreinigung: Affinity purified

Immunogen: MARVELD3 antibody was raised using the middle region of MARVELD3 corresponding to a region with amino acids SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MARVELD3 Blocking Peptide, (ABIN5614674), is also available for use as a blocking control in assays to test for specificity of this MARVELD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MARVELD3

Target: MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))

Andere Bezeichnung: MARVELD3

Hintergrund: MARVELD3 is involved in membrane apposition and fusion events.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization