BTNL8 Antikörper (Butyrophilin-Like 8) (N-Term)

Details for Product anti-BTNL8 Antibody No. ABIN634963
Antigen
Epitop
N-Term
17
8
7
2
2
1
Reaktivität
Human
26
1
Wirt
Kaninchen
26
Klonalität
Polyklonal
Konjugat
Dieser BTNL8 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
26
17
17
1
Optionen
Immunogen BTNL8 antibody was raised using the N terminal of BTNL8 corresponding to a region with amino acids MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA
Spezifität BTNL8 antibody was raised against the N terminal of BTNL8
Reinigung Affinity purified
Antigen
Andere Bezeichnung BTNL8
Hintergrund BTNL8 is a single-pass type I membrane protein. It belongs to the immunoglobulin superfamily, BTN/MOG family. BTNL8 contains 1 B30.2/SPRY domain and 1 Ig-like V-type domain. The exact function of BTNL8 remains unknown.
Molekulargewicht 57 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

BTNL8 Blocking Peptide, catalog no. 33R-5692, is also available for use as a blocking control in assays to test for specificity of this BTNL8 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL8 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Butyrophilin-Like 8 (BTNL8) (N-Term) antibody (ABIN634963) BTNL8 antibody used at 0.5 ug/ml to detect target protein.