BTNL8 Antikörper (N-Term)

Produktnummer ABIN634963

Produktdetails anti-BTNL8 Antikörper

Target: BTNL8 (Butyrophilin-Like 8 (BTNL8))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BTNL8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BTNL8 antibody was raised against the N terminal of BTNL8

Aufreinigung: Affinity purified

Immunogen: BTNL8 antibody was raised using the N terminal of BTNL8 corresponding to a region with amino acids MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BTNL8 Blocking Peptide, catalog no. 33R-5692, is also available for use as a blocking control in assays to test for specificity of this BTNL8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BTNL8

Target: BTNL8 (Butyrophilin-Like 8 (BTNL8))

Andere Bezeichnung: BTNL8 (BTNL8 Produkte)

Synonyme: Btnl8 antikoerper, BTNL8 antikoerper, butyrophilin like 8 antikoerper, butyrophilin-like 8 antikoerper, BTNL8 antikoerper, Btnl8 antikoerper, btnl8 antikoerper

Hintergrund: BTNL8 is a single-pass type I membrane protein. It belongs to the immunoglobulin superfamily, BTN/MOG family. BTNL8 contains 1 B30.2/SPRY domain and 1 Ig-like V-type domain. The exact function of BTNL8 remains unknown.

Molekulargewicht: 57 kDa (MW of target protein)