STYK1 Antikörper (serine/threonine/tyrosine Kinase 1) (C-Term)

Details for Product anti-STYK1 Antibody No. ABIN634962
Antigen
Epitop
C-Term
10
9
9
6
4
3
2
1
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus), Hund
90
44
24
4
4
4
3
3
1
Wirt
Kaninchen
70
20
Klonalität
Polyklonal
Konjugat
Dieser STYK1 Antikörper ist unkonjugiert
5
3
3
3
3
3
3
3
3
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
68
42
13
11
11
2
2
2
1
1
Optionen
Immunogen STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI
Spezifität STYK1 antibody was raised against the C terminal of STYK1
Reinigung Affinity purified
Antigen
Andere Bezeichnung STYK1 (STYK1 Antibody Abstract)
Hintergrund Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival.
Molekulargewicht 47 kDa (MW of target protein)
Applikations-hinweise WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

STYK1 Blocking Peptide, catalog no. 33R-7060, is also available for use as a blocking control in assays to test for specificity of this STYK1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STYK1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-serine/threonine/tyrosine Kinase 1 (STYK1) (C-Term) antibody (ABIN634962) STYK1 antibody used at 0.25 ug/ml to detect target protein.