NrCAM Antikörper (N-Term)
-
- Target Alle NrCAM (NRCAM) Antikörper anzeigen
- NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NrCAM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NRCAM antibody was raised against the N terminal of NRCAM
- Aufreinigung
- Affinity purified
- Immunogen
- NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK
- Top Product
- Discover our top product NRCAM Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NRCAM Blocking Peptide, catalog no. 33R-7194, is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRCAM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))
- Andere Bezeichnung
- NRCAM (NRCAM Produkte)
- Hintergrund
- Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.
- Molekulargewicht
- 84 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-