Neuronal Cell Adhesion Molecule (NRCAM) (N-Term) Antikörper

Details zu Produkt Nr. ABIN634961
Antigen
Epitop
N-Term
44
25
5
4
4
3
2
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus), Hund, Zebrafisch (Danio rerio)
62
54
35
4
4
3
3
3
3
1
1
Wirt
Kaninchen
60
23
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
4
3
3
3
3
3
3
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
78
37
34
32
7
2
2
1
1
Optionen
Immunogen NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK
Spezifität NRCAM antibody was raised against the N terminal of NRCAM
Reinigung Affinity purified
Antigen
Andere Bezeichnung NRCAM (NRCAM Antibody Abstract)
Hintergrund Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.
Molekulargewicht 84 kDa (MW of target protein)
Pathways Regulation of Cell Size
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

NRCAM Blocking Peptide, catalog no. 33R-7194, is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRCAM antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Neuronal Cell Adhesion Molecule (NRCAM) (N-Term) antibody (ABIN634961) NRCAM antibody used at 0.5 ug/ml to detect target protein.