NrCAM Antikörper (N-Term)
Kurzübersicht für NrCAM Antikörper (N-Term) (ABIN634961)
Target
Alle NrCAM (NRCAM) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- NRCAM antibody was raised against the N terminal of NRCAM
-
Aufreinigung
- Affinity purified
-
Immunogen
- NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK
-
-
-
-
Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
NRCAM Blocking Peptide, (ABIN5615061), is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRCAM antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))
-
Andere Bezeichnung
- NRCAM
-
Hintergrund
- Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.
-
Molekulargewicht
- 84 kDa (MW of target protein)
-
Pathways
- Regulation of Cell Size
Target
-