Thymopoietin Antikörper (N-Term)
-
- Target Alle Thymopoietin (TMPO) Antikörper anzeigen
- Thymopoietin (TMPO)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Thymopoietin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Thymopoietin antibody was raised against the N terminal of TMPO
- Aufreinigung
- Affinity purified
- Immunogen
- Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP
- Top Product
- Discover our top product TMPO Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Thymopoietin Blocking Peptide, catalog no. 33R-7041, is also available for use as a blocking control in assays to test for specificity of this Thymopoietin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPO antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Thymopoietin (TMPO)
- Andere Bezeichnung
- Thymopoietin (TMPO Produkte)
- Synonyme
- LAP2 antikoerper, CMD1T antikoerper, LEMD4 antikoerper, PRO0868 antikoerper, TP antikoerper, lap2 antikoerper, LAP2beta antikoerper, 5630400D24Rik antikoerper, AI195756 antikoerper, AI606875 antikoerper, AW214352 antikoerper, AW547477 antikoerper, tmpo antikoerper, wu:fc26f12 antikoerper, wu:fd21f02 antikoerper, wu:fi29h05 antikoerper, thymopoietin antikoerper, thymopoietin S homeolog antikoerper, thymopoietin a antikoerper, TMPO antikoerper, Tmpo antikoerper, tmpo.S antikoerper, tmpoa antikoerper
- Hintergrund
- TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.
- Molekulargewicht
- 39 kDa (MW of target protein)
-