OMG Antikörper (Oligodendrocyte Myelin Glycoprotein) (Middle Region)

Details for Product anti-OMG Antibody No. ABIN634958
Antigen
Epitop
Middle Region
15
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human
78
33
25
4
4
4
3
3
1
1
1
1
Wirt
Kaninchen
66
8
5
1
Klonalität
Polyklonal
Konjugat
Dieser OMG Antikörper ist unkonjugiert
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
42
36
19
13
10
1
1
Optionen
Immunogen OMG antibody was raised using the middle region of OMG corresponding to a region with amino acids NTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTN
Spezifität OMG antibody was raised against the middle region of OMG
Reinigung Affinity purified
Antigen
Andere Bezeichnung OMG (OMG Antibody Abstract)
Hintergrund OMG is a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.
Molekulargewicht 49 kDa (MW of target protein)
Pathways Neurotrophin Signalübertragung, Regulation of Cell Size
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

OMG Blocking Peptide, catalog no. 33R-6901, is also available for use as a blocking control in assays to test for specificity of this OMG antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMG antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Oligodendrocyte Myelin Glycoprotein (OMG) (Middle Region) antibody (ABIN634958) OMG antibody used at 1 ug/ml to detect target protein.