OMG Antikörper (Middle Region)

Produktnummer ABIN634958

Der Kaninchen Polyklonal Anti-OMG-Antikörper wurde für WB validiert. Er ist geeignet, OMG in Proben von Human zu detektieren.

Kurzübersicht für OMG Antikörper (Middle Region) (ABIN634958)

Target: OMG (Oligodendrocyte Myelin Glycoprotein (OMG))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OMG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OMG Antikörper

Bindungsspezifität: Middle Region

Spezifität: OMG antibody was raised against the middle region of OMG

Aufreinigung: Affinity purified

Immunogen: OMG antibody was raised using the middle region of OMG corresponding to a region with amino acids NTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OMG Blocking Peptide, (ABIN5615124), is also available for use as a blocking control in assays to test for specificity of this OMG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OMG

Target: OMG (Oligodendrocyte Myelin Glycoprotein (OMG))

Andere Bezeichnung: OMG

Hintergrund: OMG is a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung, Regulation of Cell Size