MOG Antikörper (N-Term)

Produktnummer ABIN634957

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MOG in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für MOG Antikörper (N-Term) (ABIN634957)

Target: MOG (Myelin Oligodendrocyte Glycoprotein (MOG))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MOG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MOG Antikörper

Bindungsspezifität: N-Term

Spezifität: OMG antibody was raised against the N terminal of OMG

Aufreinigung: Affinity purified

Immunogen: OMG antibody was raised using the N terminal of OMG corresponding to a region with amino acids ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OMG Blocking Peptide, (ABIN936789), is also available for use as a blocking control in assays to test for specificity of this OMG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MOG

Target: MOG (Myelin Oligodendrocyte Glycoprotein (MOG))

Andere Bezeichnung: OMG

Hintergrund: OMG is a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung, Regulation of Cell Size