ENTPD8 Antikörper (N-Term)

Produktnummer ABIN634955

Produktdetails anti-ENTPD8 Antikörper

Target: ENTPD8 (Ectonucleoside Triphosphate diphosphohydrolase 8 (ENTPD8))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ENTPD8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ENTPD8 antibody was raised against the N terminal of ENTPD8

Aufreinigung: Affinity purified

Immunogen: ENTPD8 antibody was raised using the N terminal of ENTPD8 corresponding to a region with amino acids IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ENTPD8 Blocking Peptide, catalog no. 33R-4087, is also available for use as a blocking control in assays to test for specificity of this ENTPD8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENTPD8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ENTPD8

Target: ENTPD8 (Ectonucleoside Triphosphate diphosphohydrolase 8 (ENTPD8))

Andere Bezeichnung: ENTPD8 (ENTPD8 Produkte)

Synonyme: GLSR2492 antikoerper, NTPDase-8 antikoerper, UNQ2492 antikoerper, ENTPD1 antikoerper, zC10E8.4 antikoerper, zgc:92065 antikoerper, si:ch211-10e8.4 antikoerper, ectonucleoside triphosphate diphosphohydrolase 8 antikoerper, ectonucleoside triphosphate diphosphohydrolase 8 L homeolog antikoerper, ENTPD8 antikoerper, Entpd8 antikoerper, entpd8 antikoerper, entpd8.L antikoerper, Tsp_07798 antikoerper

Hintergrund: ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP.

Molekulargewicht: 54 kDa (MW of target protein)