FTHL17 Antikörper (Middle Region)

Produktnummer ABIN634953

Dieses Anti-FTHL17-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FTHL17 in WB. Geeignet für Human.

Kurzübersicht für FTHL17 Antikörper (Middle Region) (ABIN634953)

Target: FTHL17 (Ferritin, Heavy Polypeptide-Like 17 (FTHL17))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FTHL17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FTHL17 Antikörper

Bindungsspezifität: Middle Region

Spezifität: FTHL17 antibody was raised against the middle region of FTHL17

Aufreinigung: Affinity purified

Immunogen: FTHL17 antibody was raised using the middle region of FTHL17 corresponding to a region with amino acids FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FTHL17 Blocking Peptide, (ABIN938344), is also available for use as a blocking control in assays to test for specificity of this FTHL17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTHL17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FTHL17

Target: FTHL17 (Ferritin, Heavy Polypeptide-Like 17 (FTHL17))

Andere Bezeichnung: FTHL17

Hintergrund: This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis