ABHD13 Antikörper (C-Term)

Produktnummer ABIN634950

Dieses Anti-ABHD13-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ABHD13 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ABHD13 Antikörper (C-Term) (ABIN634950)

Target: ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABHD13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABHD13 Antikörper

Bindungsspezifität: C-Term

Spezifität: ABHD13 antibody was raised against the C terminal of ABHD13

Aufreinigung: Affinity purified

Immunogen: ABHD13 antibody was raised using the C terminal of ABHD13 corresponding to a region with amino acids LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABHD13 Blocking Peptide, (ABIN940161), is also available for use as a blocking control in assays to test for specificity of this ABHD13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABHD13

Target: ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))

Andere Bezeichnung: ABHD13

Hintergrund: ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.

Molekulargewicht: 38 kDa (MW of target protein)