TMEM163 Antikörper (Middle Region)

Produktnummer ABIN634949

Der Kaninchen Polyklonal Anti-TMEM163-Antikörper wurde für WB validiert. Er ist geeignet, TMEM163 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für TMEM163 Antikörper (Middle Region) (ABIN634949)

Target: TMEM163 (Transmembrane Protein 163 (TMEM163))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM163 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM163 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMEM163 antibody was raised against the middle region of TMEM163

Aufreinigung: Affinity purified

Immunogen: TMEM163 antibody was raised using the middle region of TMEM163 corresponding to a region with amino acids AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM163 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM163 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM163 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM163

Target: TMEM163 (Transmembrane Protein 163 (TMEM163))

Andere Bezeichnung: TMEM163

Hintergrund: The function of TMEM163 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 31 kDa (MW of target protein)