IL22 Receptor alpha 1 Antikörper (Middle Region)

Produktnummer ABIN634946

Der Kaninchen Polyklonal Anti-IL22 Receptor alpha 1-Antikörper wurde für WB validiert. Er ist geeignet, IL22 Receptor alpha 1 in Proben von Human und Maus zu detektieren.

Kurzübersicht für IL22 Receptor alpha 1 Antikörper (Middle Region) (ABIN634946)

Target: IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL22 Receptor alpha 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL22 Receptor alpha 1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: IL22 R alpha 1 antibody was raised against the middle region of IL22 A1

Aufreinigung: Affinity purified

Immunogen: IL22 R alpha 1 antibody was raised using the middle region of IL22 A1 corresponding to a region with amino acids YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL22R alpha 1 Blocking Peptide, (ABIN936210), is also available for use as a blocking control in assays to test for specificity of this IL22R alpha 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL22 Receptor alpha 1

Target: IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))

Andere Bezeichnung: IL22R alpha 1

Hintergrund: IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4).

Molekulargewicht: 63 kDa (MW of target protein)