Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

MFF Antikörper (C-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MFF in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.
Produktnummer ABIN634945

Kurzübersicht für MFF Antikörper (C-Term) (ABIN634945)

Target

Alle MFF Antikörper anzeigen
MFF (Mitochondrial Fission Factor (MFF))

Reaktivität

  • 32
  • 17
  • 12
  • 12
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 47
  • 3
Kaninchen

Klonalität

  • 46
  • 4
Polyklonal

Konjugat

  • 21
  • 4
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser MFF Antikörper ist unkonjugiert

Applikation

  • 39
  • 18
  • 13
  • 13
  • 9
  • 4
  • 3
  • 3
  • 3
  • 2
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 15
    • 7
    • 5
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    C-Term

    Spezifität

    C2 ORF33 antibody was raised against the C terminal Of C2 rf33

    Aufreinigung

    Affinity purified

    Immunogen

    C2 ORF33 antibody was raised using the C terminal Of C2 rf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    C2ORF33 Blocking Peptide, (ABIN5612504), is also available for use as a blocking control in assays to test for specificity of this C2ORF33 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    MFF (Mitochondrial Fission Factor (MFF))

    Andere Bezeichnung

    C2ORF33

    Hintergrund

    C2orf33 plays a role in mitochondrial and peroxisomal fission.

    Molekulargewicht

    38 kDa (MW of target protein)
Sie sind hier:
Chat with us!