TMEM30A Antikörper (N-Term)

Produktnummer ABIN634944

Dieses Anti-TMEM30A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TMEM30A in WB und IHC. Geeignet für Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für TMEM30A Antikörper (N-Term) (ABIN634944)

Target: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM30A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-TMEM30A Antikörper

Bindungsspezifität: N-Term

Spezifität: TMEM30 A antibody was raised against the N terminal of TMEM30

Aufreinigung: Affinity purified

Immunogen: TMEM30 A antibody was raised using the N terminal of TMEM30 corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM30A Blocking Peptide, (ABIN938480), is also available for use as a blocking control in assays to test for specificity of this TMEM30A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM30A

Target: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Andere Bezeichnung: TMEM30A

Hintergrund: The function of TMEM30A protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 41 kDa (MW of target protein)